Euro
USD
British Pound
NULL
Product Description
Rabbit IgG polyclonal antibody for 5-hydroxytryptamine receptor 3A(HTR3A) detection. Tested with WB in Human;Mouse;Rat.
Product Videos
Custom Field
Size 100 ug/vial
Clonality Polyclonal
Ig type Rabbit IgG
Specificity No cross reactivity with other proteins.
Reactivity Reacts with: human, mouse, rat
Application WB
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human 5HT3A receptor (72-108aa NVDEKNQVLTTYIWYRQYWTDEFLQWNPEDFDNITK L), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amin
Contents Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification Immunogen affinity purified.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage At -20?C for one year. After reconstitution, at 4?C for one month. It can also be aliquotted and stored frozen at -20?C for a longer time. Avoid repeated freezing and thawing.
Protein Name 5-hydroxytryptamine receptor 3A
Gene Name HTR3A
