Product Description
Rabbit IgG polyclonal antibody for A disintegrin and metalloproteinase with thrombospondin motifs 5(ADAMTS5) detection. Tested with WB in Human.
Size
Size 100 ug/vial
Clonality Polyclonal
Ig type Rabbit IgG
Specificity No cross reactivity with other proteins.
Reactivity Reacts with: human
Application WB
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human ADAMTS5 (755-787aa ATHIKVRQFKAKDQTRFTAYLALKKKNGEYLIN), different from the related mouse sequence by one amino acid.
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification Immunogen affinity purified.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage At -20?C for one year. After reconstitution, at 4?C for one month. It can also be aliquotted and stored frozen at -20?C for a longer time. Avoid repeated freezing and thawing.
Protein Name A disintegrin and metalloproteinase with thrombospondin motifs 5
Gene Name ADAMTS5