Euro
USD
British Pound
NULL
Product Description
Mouse IgG monoclonal antibody for Beta Tubulin detection. Tested with WB, FCM in Human;Mouse;Rat.
Product Videos
Custom Field
Size 100 ug/vial
Clonality Monoclonal
Ig type Mouse IgG2a
Specificity No cross reactivity with other proteins.
Reactivity Reacts with: human, mouse, rat
Application WB,FCM
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human Beta Tubulin (383-412aa EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE), identical to the related mouse and rat sequences.
Contents Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification Immunogen affinity purified.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500?g/ml.
Storage At -20?C for one year. After reconstitution, at 4?C for one month. It can also be aliquotted and stored frozen at -20?C for a longer time. Avoid repeated freezing and thawing.
Protein Name Tubulin beta chain
Gene Name TUBB
