A synthetic peptide corresponding to a sequence at the C-terminus of human CCT3 (497-536aa EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ), different from the related mouse and rat sequences by one amino acid.
Add 0.2ml of distilled water will yield a concentration of 500?g/ml.
Storage:
At -20?C for one year. After reconstitution, at 4?C for one month. It can also be aliquotted and stored frozen at -20?C for a longer time. Avoid repeated freezing and thawing.
Mouse IgG monoclonal antibody for CCT3 detection. Tested with WB in Human.
Product Videos
Custom Field
Size100 ug/vial
ClonalityMonoclonal
Ig typeMouse IgG1
SpecificityNo cross reactivity with other proteins.
ReactivityReacts with: human
ApplicationWB
ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human CCT3 (497-536aa EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ), different from the related mouse and rat sequences by one amino acid.
ReconstitutionAdd 0.2ml of distilled water will yield a concentration of 500?g/ml.
StorageAt -20?C for one year. After reconstitution, at 4?C for one month. It can also be aliquotted and stored frozen at -20?C for a longer time. Avoid repeated freezing and thawing.