Euro
USD
British Pound
NULL
Product Description
Mouse IgG monoclonal antibody for CCT3 detection. Tested with WB in Human.
Product Videos
Size
Size 100 ug/vial
Clonality Monoclonal
Ig type Mouse IgG1
Specificity No cross reactivity with other proteins.
Reactivity Reacts with: human
Application WB
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human CCT3 (497-536aa EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ), different from the related mouse and rat sequences by one amino acid.
Contents Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification Immunogen affinity purified.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500?g/ml.
Storage At -20?C for one year. After reconstitution, at 4?C for one month. It can also be aliquotted and stored frozen at -20?C for a longer time. Avoid repeated freezing and thawing.
Protein Name T-complex protein 1 subunit gamma
Gene Name CCT3
