Product Description
Rabbit IgG polyclonal antibody for 2',3'-cyclic-nucleotide 3'-phosphodiesterase(CNP) detection. Tested with WB in Human;Mouse;Rat.
Size
Size 100 ug/vial
Clonality Polyclonal
Ig type Rabbit IgG
Specificity No cross reactivity with other proteins.
Reactivity Reacts with: human, mouse, rat
Application WB
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human CNPase (142-178aa QYQVVLVEPKTAWRLDCAQLKEKNQWQLSADDLKKLK), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification Immunogen affinity purified.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage At -20?C for one year. After reconstitution, at 4?C for one month. It can also be aliquotted and stored frozen at -20?C for a longer time. Avoid repeated freezing and thawing.
Protein Name 2',3'-cyclic-nucleotide 3'-phosphodiesterase
Gene Name CNP