Euro
USD
British Pound
NULL
Product Description
Mouse IgG monoclonal antibody for EWSR1 detection. Tested with WB, IHC-P in Human;Mouse;Monkey.
Product Videos
Size
Size 100 ug/vial
Clonality Monoclonal
Ig type Mouse IgG2b
Specificity No cross reactivity with other proteins.
Reactivity Reacts with: human, mouse, monkey
Application WB,IHC-P
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human EWSR1 (369-399aa NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH), different from the related mouse sequence by one amino acid.
Contents Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification Immunogen affinity purified.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500?g/ml.
Storage At -20?C for one year. After reconstitution, at 4?C for one month. It can also be aliquotted and stored frozen at -20?C for a longer time. Avoid repeated freezing and thawing.
Protein Name RNA-binding protein EWS
Gene Name EWSR1
