Euro
USD
British Pound
NULL
Product Description
Rabbit IgG Polyclonal Anti-Human ACTN3 Antibody DyLight® 488 Conjugated, Flow Validated.
Product Videos
Custom Field
Size 100 ug/vial
Clonality Polyclonal
Ig type Rabbit IgG
Specificity No cross reactivity with other proteins.
Reactivity Reacts with: human
Application FCM
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human ACTN3 (574-617aa EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINT K), different from the related mouse sequence by five amino acids.
Contents Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
Purification Immunogen affinity purified.
Reconstitution N/A
Storage At 2-8?C for one year. Protect from light. Do not freeze.
Protein Name Alpha-actinin-3
Gene Name ACTN3
