Euro
USD
British Pound
NULL
Product Description
Rabbit IgG Polyclonal Anti-Human BMP5 Antibody DyLight® 550 Conjugated, Flow Validated.
Product Videos
Custom Field
Size 100 ug/vial
Clonality Polyclonal
Ig type Rabbit IgG
Specificity No cross reactivity with other proteins.
Reactivity Reacts with: human
Application FCM
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human BMP5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL), different from the related mouse sequence by three amino acids.
Contents Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
Purification Immunogen affinity purified.
Reconstitution N/A
Storage At 2-8?C for one year. Protect from light. Do not freeze.
Protein Name Bone morphogenetic protein 5
Gene Name BMP5
