Euro
USD
British Pound
NULL
Product Description
Mouse IgG Monoclonal Anti-Human Emerin Antibody DyLight® 550 Conjugated, Flow Validated.
Product Videos
Custom Field
Size 100 ug/vial
Clonality Monoclonal
Ig type Mouse IgG1
Specificity No cross reactivity with other proteins.
Reactivity Reacts with: human
Application FCM
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human Emerin (1-48aa MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRL), different from the related mouse sequence by eight amino acids, and from the related rat sequence by nine ami
Contents Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
Purification Immunogen affinity purified.
Reconstitution N/A
Storage At 2-8?C for one year. Protect from light. Do not freeze.
Protein Name Emerin
Gene Name EMD
