Euro
USD
British Pound
NULL
Product Description
Mouse IgG Monoclonal Anti-Human Hsp70 Antibody DyLight® 488 Conjugated, Flow Validated.
Product Videos
Custom Field
Size 100 ug/vial
Clonality Monoclonal
Ig type Mouse IgG1
Specificity No cross reactivity with other proteins.
Reactivity Reacts with: human
Application FCM
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp70 (559-596aa KGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKR), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids
Contents Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
Purification Immunogen affinity purified.
Reconstitution N/A
Storage At 2-8?C for one year. Protect from light. Do not freeze.
Protein Name Heat shock 70 kDa protein 1A/1B
Gene Name HSPA1A/HSPA1B
