Overview Reviews Product Description Rabbit IgG Polyclonal Anti-Human SUR1 Antibody DyLight® 488 Conjugated, Flow Validated. Product Videos Custom Field Size 100 ug/vial Clonality Polyclonal Ig type Rabbit IgG Specificity No cross reactivity with other proteins. Reactivity Reacts with: human Application FCM Immunogen A synthetic peptide corresponding to a sequence of human SUR1 (TIQREGTLKDFQ RSECQLFEHWKTLMNRQDQELEKETVTERKA). Contents Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3. Purification Immunogen affinity purified. Reconstitution N/A Storage At 2-8?C for one year. Protect from light. Do not freeze. Protein Name ATP-binding cassette sub-family C member 8 Gene Name ABCC8 Product Reviews Write a Review Write a Review × Anti-Human SUR1 DyLight® 488 conjugated Antibody Rating * Select Rating 1 star (worst) 2 stars 3 stars (average) 4 stars 5 stars (best) Name Review Subject * Comments *
Quick view Details Goat anti-Human IgG Fc, DyLight® 488 conjugated | AS10 789 MSRP: Now: NULL255.00 Add to Cart Quick view Details Rabbit Anti-Human, Mouse Ceramide Kinase Polyclonal Antibody [DyLight 488 Conjugated] | EA-0033Y MSRP: Now: NULL1,592.00 Add to Cart Quick view Details Goat anti-Human IgG (H&L), DyLight® 488 conjugated | AS10 765 MSRP: Now: NULL255.00 Add to Cart Quick view Details Goat anti-Rabbit IgG Fc, DyLight® 488 conjugated | AS16 3536 MSRP: Now: NULL270.00 Add to Cart Quick view Details 20S Proteasome Antibody- Dylight 488 MSRP: Now: NULL369.00 Add to Cart Quick view Details Goat anti-Human IgA (alpha chain), DyLight® 488 conjugated | AS10 734 MSRP: Now: NULL328.00 Add to Cart ×
Quick view Details Rabbit Anti-Human, Mouse Ceramide Kinase Polyclonal Antibody [DyLight 488 Conjugated] | EA-0033Y MSRP: Now: NULL1,592.00 Add to Cart Quick view Details Goat anti-Human IgG (H&L), DyLight® 488 conjugated | AS10 765 MSRP: Now: NULL255.00 Add to Cart Quick view Details Goat anti-Rabbit IgG Fc, DyLight® 488 conjugated | AS16 3536 MSRP: Now: NULL270.00 Add to Cart Quick view Details 20S Proteasome Antibody- Dylight 488 MSRP: Now: NULL369.00 Add to Cart Quick view Details Goat anti-Human IgA (alpha chain), DyLight® 488 conjugated | AS10 734 MSRP: Now: NULL328.00 Add to Cart ×
Quick view Details Goat anti-Human IgG (H&L), DyLight® 488 conjugated | AS10 765 MSRP: Now: NULL255.00 Add to Cart Quick view Details Goat anti-Rabbit IgG Fc, DyLight® 488 conjugated | AS16 3536 MSRP: Now: NULL270.00 Add to Cart Quick view Details 20S Proteasome Antibody- Dylight 488 MSRP: Now: NULL369.00 Add to Cart Quick view Details Goat anti-Human IgA (alpha chain), DyLight® 488 conjugated | AS10 734 MSRP: Now: NULL328.00 Add to Cart ×
Quick view Details Goat anti-Rabbit IgG Fc, DyLight® 488 conjugated | AS16 3536 MSRP: Now: NULL270.00 Add to Cart Quick view Details 20S Proteasome Antibody- Dylight 488 MSRP: Now: NULL369.00 Add to Cart Quick view Details Goat anti-Human IgA (alpha chain), DyLight® 488 conjugated | AS10 734 MSRP: Now: NULL328.00 Add to Cart ×
Quick view Details 20S Proteasome Antibody- Dylight 488 MSRP: Now: NULL369.00 Add to Cart Quick view Details Goat anti-Human IgA (alpha chain), DyLight® 488 conjugated | AS10 734 MSRP: Now: NULL328.00 Add to Cart ×
Quick view Details Goat anti-Human IgA (alpha chain), DyLight® 488 conjugated | AS10 734 MSRP: Now: NULL328.00 Add to Cart