Euro
USD
British Pound
NULL
Product Description
Mouse IgG Monoclonal Anti-Human TCP1 alpha Antibody DyLight® 550 Conjugated, Flow Validated.
Product Videos
Custom Field
Size 100 ug/vial
Clonality Monoclonal
Ig type Mouse IgG1
Specificity No cross reactivity with other proteins.
Reactivity Reacts with: human
Application FCM
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human TCP1 alpha (515-551aa KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids
Contents Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
Purification Immunogen affinity purified.
Reconstitution N/A
Storage At 2-8?C for one year. Protect from light. Do not freeze.
Protein Name T-complex protein 1 subunit alpha
Gene Name TCP1
