Euro
USD
British Pound
NULL
Product Description
Rabbit IgG polyclonal antibody for Runt-related transcription factor 1(RUNX1) detection. Tested with WB, IHC-P, IHC-F in Human;Mouse;Rat.
Product Videos
Custom Field
Size 100 ug/vial
Clonality Polyclonal
Ig type Rabbit IgG
Specificity No cross reactivity with other proteins.
Reactivity Reacts with: human, mouse, rat
Application WB,IHC-P,IHC-F
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human RUNX1(200-233aa ELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFN), identical to the related mouse and rat sequences.
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification Immunogen affinity purified.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage At -20?C for one year. After reconstitution, at 4?C for one month. It can also be aliquotted and stored frozen at -20?C for a longer time. Avoid repeated freezing and thawing.
Protein Name Runt-related transcription factor 1
Gene Name RUNX1
