Euro
USD
British Pound
NULL
Product Description
Rabbit IgG polyclonal antibody for Double-stranded RNA-binding protein Staufen homolog 1(STAU1) detection. Tested with WB in Human.
Product Videos
Custom Field
Size 100 ug/vial
Clonality Polyclonal
Ig type Rabbit IgG
Specificity No cross reactivity with other proteins.
Reactivity Reacts with: human
Application WB
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human Staufen (532-568aa HGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGN), identical to the related mouse sequence.
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification Immunogen affinity purified.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage At -20?C for one year. After reconstitution, at 4?C for one month. It can also be aliquotted and stored frozen at -20?C for a longer time. Avoid repeated freezing and thawing.
Protein Name Double-stranded RNA-binding protein Staufen homolog 1
Gene Name STAU1
