Euro
USD
British Pound
NULL
Product Description
Goat Polyclonal antibody for TNFRSF10C detection. Tested positive for Flow Cytometry, IF, IHC, WB in Human
Product Videos
Size
Size 200 ug
Host Goat
Category Primary Antibodies
Gene name TNFRSF10C
Clonality Polyclonal
Clone N/A
concentration 0.5-1mg/ml, actual concentration vary by lot. Use suggested dilution ratio to decide dilution procedure.
Contents Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide.
Immunogen Synthetic peptide corresponding to aa 33-63 (E33VPQQTVAPQQQRHSFKGEECPAGSHRSEHT63) of the extracellular domain of human TRAIL-R3.
Form Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide.
Purification Epitope-affinity purified IgG.
Storage -20°C
Reactivity Human
Uniprot ID O14798
Note This product is available in other size, please contact us for more details
![TRAIL-R3 Antibody [HS301]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/553836/761833/porsci_lo__79508.1648973713__04766.1649086276.png?c=2 "TRAIL-R3 Antibody [HS301]")
![TRAIL-R3 Antibody [TR3.06]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/553841/761838/porsci_lo__79508.1648973713__15373.1649086277.png?c=2 "TRAIL-R3 Antibody [TR3.06]")
