Product Description
Rabbit IgG polyclonal antibody for Zinc finger and BTB domain-containing protein 7A(ZBTB7A) detection. Tested with WB, IHC-P in Mouse;Rat.
Size
Size 100 ug/vial
Clonality Polyclonal
Ig type Rabbit IgG
Specificity No cross reactivity with other proteins.
Reactivity Reacts with: mouse, rat
Application WB,IHC-P
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of mouse ZBTB7A (125-163aa DLLERQILAADDVGDASQPDGAGPTDQRNLLRAKEYLEF), different from the related human sequence by eleven amino acids, and from the related rat sequence by one amino aci
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification Immunogen affinity purified.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage At -20?C for one year. After reconstitution, at 4?C for one month. It can also be aliquotted and stored frozen at -20?C for a longer time. Avoid repeated freezing and thawing.
Protein Name Zinc finger and BTB domain-containing protein 7A
Gene Name ZBTB7A