Euro
USD
British Pound
NULL
Product Description
Mouse Anti-Rat SUR1 and SUR2B Monoclonal IgG1
Product Videos
Custom Field
Size 100 µg
Other Name SUR1 and SUR2B Antibody: Biotin
Target SUR1/SUR2B
Conjugate Biotin
Research Area Neuroscience, Cell Markers, Neuron Markers, Membrane Markers, Cell Signaling, Cancer, cardiovascular System, Atherosclerosis, Heart
Alternative Name(s) ABC36 Antibody, Abcc8 Antibody, ABCC8_HUMAN Antibody, ATP binding cassette sub family C (CFTR/MRP) member 8 Antibody, ATP binding cassette transporter sub family C member 8 (1) Antibody, ATP-binding cassette sub-family C member 8 Antibody, HHF1 Antib
Product Type Monoclonal Antibody
Clone Number S323A-31
Immunogen Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B
Immunogen Species Rat
Applications WB, ICC/IF
Host Mouse
Isotype IgG1
Species Reactivity Mouse, Rat
Antibody Dilution WB (1:1000), IHC (1:1000), ICC/IF (1:100); optimal dilutions for assays should be determined by the user.
Purification Protein G Purified
Storage Buffer PBS pH7.4, 50% glycerol, 0.09% sodium azide
Concentration 1 mg/ml
Specificity Detects ~175kDa and smaller fragments likely due to proteolytic cleavage.
Storage -20ºC
Shipping Blue Ice or 4ºC
Certificate of Analysis 1 µg/ml of SMC-432 was sufficient for detection of SUR1 and SUR2B in 20 µg of mouse brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.
Cellular Localization Membrane
Accession Number NP_037172.2
Gene ID 25560
Swiss-Prot Q63563
Field of Use Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only.
