Product Description
DPY19L2 antibody | 70R-7084 | Fitzgerald
Activity Code: ACTIVE
Product Type: Primary Antibodies
Product Subtype: Purified Polyclonal Antibodies
Research Area: Cell Biology
Short Description: Rabbit polyclonal DPY19L2 antibody
Immunogen: DPY19L2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IIGEFNNLPQEELLQWIKYSTTSDAVFAGAMPTMASIKLSTLHPIVNHPH
Host: Rabbit
Specificity: N/A
Cross Reactivity: Human, Rat
Isotype: N/A
IClone: N/A
Species: N/A
Residues: N/A
Tag/conjugate: N/A
Protein Type: N/A
Expression System: N/A
Grade & Purity: N/A
Methode of Purification: Affinity purified
Source: N/A
Concentration: N/A
Form & Buffer: Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Storage: Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Shipping Information: *Blue Ice*
Applications: WB
Bioactivity: N/A
Usage Recommendations: WB: 1 ug/ml
Assay Information: DPY19L2 Blocking Peptide, catalog no. 33R-3998, is also available for use as a blocking control in assays to test for specificity of this DPY19L2 antibody
Euro
USD
British Pound
NULL