Product Description
PAP2D antibody | 70R-6622 | Fitzgerald
Activity Code: ACTIVE
Product Type: Primary Antibodies
Product Subtype: Purified Polyclonal Antibodies
Research Area: Signal Transduction
Short Description: Rabbit polyclonal PAP2D antibody raised against the N terminal of PAP2D
Immunogen: PAP2D antibody was raised using the N terminal of PAP2D corresponding to a region with amino acids FTVNVQGFFCHDSAYRKPYPGPEDSSAVPPVLLYSLAAGVPVLVIIVGET
Host: Rabbit
Specificity: PAP2D antibody was raised against the N terminal of PAP2D
Cross Reactivity: Human, Mouse, Rat
Isotype: N/A
IClone: N/A
Species: N/A
Residues: N/A
Tag/conjugate: N/A
Protein Type: N/A
Expression System: N/A
Grade & Purity: N/A
Methode of Purification: Affinity purified
Source: N/A
Concentration: N/A
Form & Buffer: Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Storage: Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Shipping Information: *Blue Ice*
Applications: WB
Bioactivity: N/A
Usage Recommendations: WB: 1 ug/ml
Assay Information: PAP2D Blocking Peptide, catalog no. 33R-3109, is also available for use as a blocking control in assays to test for specificity of this PAP2D antibody
Euro
USD
British Pound
NULL