Product Description
PTK2B antibody | 70R-1706 | Fitzgerald
Activity Code: ACTIVE
Product Type: Primary Antibodies
Product Subtype: Purified Polyclonal Antibodies
Research Area: Cytokines & Growth Factors
Short Description: Rabbit polyclonal PTK2B antibody raised against the C terminal of PTK2B
Immunogen: PTK2B antibody was raised using the C terminal of PTK2B corresponding to a region with amino acids QKQMVEDYQWLRQEEKSLDPMVYMNDKSPLTPEKEVGYLEFTGPPQKPPR
Host: Rabbit
Specificity: PTK2B antibody was raised against the C terminal of PTK2B
Cross Reactivity: Human, Mouse, Rat, Dog
Isotype: N/A
IClone: N/A
Species: N/A
Residues: N/A
Tag/conjugate: N/A
Protein Type: N/A
Expression System: N/A
Grade & Purity: N/A
Methode of Purification: Total IgG Protein A purified
Source: N/A
Concentration: N/A
Form & Buffer: Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Storage: Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Shipping Information: *Blue Ice*
Applications: WB
Bioactivity: N/A
Usage Recommendations: WB: 1.25 ug/ml
Assay Information: PTK2B Blocking Peptide, catalog no. 33R-7611, is also available for use as a blocking control in assays to test for specificity of this PTK2B antibody
Euro
USD
British Pound
NULL