Euro
USD
British Pound
NULL
Product Description
SPATA2L antibody | 70R-3641 | Fitzgerald
Activity Code: ACTIVE
Product Type: Primary Antibodies
Product Subtype: Purified Polyclonal Antibodies
Research Area: Protein Modification & Stress Response
Short Description: Rabbit polyclonal SPATA2L antibody raised against the middle region of SPATA2L
Immunogen: SPATA2L antibody was raised using the middle region of SPATA2L corresponding to a region with amino acids SPPAELAYRPPLWEQSAKLWGTGGRAWEPPAEELPQASSPPYGALEEGLE
Host: Rabbit
Specificity: SPATA2L antibody was raised against the middle region of SPATA2L
Cross Reactivity: Human
Isotype: N/A
IClone: N/A
Species: N/A
Residues: N/A
Tag/conjugate: N/A
Protein Type: N/A
Expression System: N/A
Grade & Purity: N/A
Methode of Purification: Affinity purified
Source: N/A
Concentration: N/A
Form & Buffer: Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Storage: Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Shipping Information: *Blue Ice*
Applications: WB
Bioactivity: N/A
Usage Recommendations: WB: 1 ug/ml
Assay Information: SPATA2L Blocking Peptide, catalog no. 33R-8686, is also available for use as a blocking control in assays to test for specificity of this SPATA2L antibody
