Product Description
SARS Coronavirus Envelope (HSZ-Cc) Recombinant Protein | 20-197 | ProSci
Tested Application: N/A
Application: N/A
Tpredicted Molecular Weight: Mono-Isotopic Mass: 52, 566.88 daltons
Average Mass: 52, 599.92 daltons
Physical State: Liquid
Buffer: 50 mM Tris-HCl pH 7.5, 270 mM Sucrose, 150 mM NaCl, 0.1 mM EGTA, 0.1 % 2-mercaptoethanol, 0.03 % Brij-35
Storage Condition: Store at -70 °C. Avoid repeated freeze-thaw cycles.
Alternate Name: SARS-CoV-HSZ-Cc-E Protein, E Protein SARS-CoV-HSZ-Cc, Envelope Protein SARS-CoV-HSZ-Cc, SARS-CoV-HSZ-Cc Envelope Protein
Background: N/A
Shipping: Dry Ice
Disclaimer: Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.
Source: bacteria
Species: SARS
By Source: Other
By Species: Other
Fusion Tag: N-Term MBP Uncleaved
Sequence: Native Sequence:
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELVKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSNNNNNNNNNNLGDDDDKVPEFLEVLFQGPLGSMYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYSRVKNLNSSEGVPDLLV
Amino acids M1 – V76 (end).
Residue M404 of the fusion protein is equivalent to M1 of the native enzyme.
The MBP tag is located at residues 1 – 367.
Protease Cleavage:
PreScission (LEVLFQGP) residues 393 – 400
Bological Activity: N/A
Purity: Amylose resin (0.75)