Product Description
The recombinant Blue Fluorescent Protein (BFP) is expressed and purified from transformed E. coli using a method that ensures high purity and maximal BFP fluorescence. The protein is a 29 kDa monomer with 259 amino acids, pI: 6.17. Ex.= 308-383 nm; Em.= 440-447 nm. The protein is engineered with 6xHis-tag on the N-terminal, which can be used for detection with anti-His-Tag antibody, or protein removal by using Ni++ beads. BFP protein sequence:MGSSHHHHHHSSGLVPRGSHMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATY GKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYIMADKQKN GIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDSHYLSTQSALSKDPNEKRDHMV LLEFVTAAGITLGMDELYK
Biovision | 4994 | Blue Fluorescent Protein BFP DataSheet
Biomolecule/Target: N/A
Synonyms: BFP, Blue Fluorescent Protein
Alternates names: Fatty acid-binding protein adipocyte, AFABP, Fatty acid-binding protein 4, Adipocyte lipid-binding protein, ALBP, A-FABP, FABP4.
Taglines: Fluorescent protein ideal for subcellular labeling/visualization
NCBI Gene ID #: 2167
NCBI Gene Symbol: FABP4
Gene Source: N/A
Accession #: P15090
Recombinant: Yes
Source: E. coli
Purity by SDS-PAGEs: 98%
Assay: SDS-PAGE
Purity: 97%
Assay #2: HPLC
Endotoxin Level: <0.1 ng/g
Activity (Specifications/test method): N/A
Biological activity: Test in process
Results: N/A
Binding Capacity: N/A
Unit Definition: N/A
Molecular Weight: 16 kDa
Concentration: N/A
Appearance: Lyophilized protein
Physical form description: Freeze Dried
Reconstitution Instructions: Reconstitute in HO to a concentration of 0.1-1.0 mg/ml. This solution can then be diluted into other aqueous buffers
Amino acid sequence: N/A
Euro
USD
British Pound
NULL