Euro
USD
British Pound
NULL
Product Description
Mouse complement C5a is a 77-amino acid peptide generated during complement activation from the -chain of complement C5. Mouse C5a shares 60% and 82% amino acid sequence identity to human and rat C5a, respectively. C5a binds to a signaling G-protein coupled receptor (GPCR) (C5aR/CD88), inducing neutrophil chemotaxis and endothelial cell activation. It also triggers an oxidative burst in macrophages and neutrophils, and induces release of histamine in basophils and mast cells. The 9 kDa mouse C5a protein expressed in E. coli contains a N-terminal His-Tag sequence.
Biovision | 4895A | C5a His-Tag murine recombinant DataSheet
Biomolecule/Target: N/A
Synonyms: Complement Fragments C5a
Alternates names: CD105, ENG, END, ORW, HHT1, ORW1, FLJ41744, Endoglin
Taglines: An anaphylatoxin
NCBI Gene ID #: Mm.225297
NCBI Gene Symbol: ENG
Gene Source: Mouse
Accession #: Q63961
Recombinant: Yes
Source: E. coli
Purity by SDS-PAGEs: 95%
Assay: SDS-PAGE
Purity: N/A
Assay #2: HPLC
Endotoxin Level: <0.1 ng/g
Activity (Specifications/test method): N/A
Biological activity: N/A
Results: 1-3 nmolar
Binding Capacity: N/A
Unit Definition: N/A
Molecular Weight: 75-85 kDa
Concentration: N/A
Appearance: Lyophilized protein
Physical form description: Sterile filtered and lyophilized with no additives
Reconstitution Instructions: Centrifuge the vial prior to opening. Reconstitute in sterile PBS to a concentration 100 µg/ml. This solution can then be diluted into other aqueous buffers.
Amino acid sequence: MDRGVLPLPITLLFVIYSFVPTTGLAERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKIFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLS
