Product Description
Human complement C5a is a 74-amino acid glycopeptide generated during complement activation from the -chain of complement C5. C5a is a potent chemotactic factor for human peripheral blood neutrophils and monocytes, and is believed to play an important role in a number of inflammatory conditions. The 74 amino acid, human C5a protein expressed in E. coli has an activity similar to that of serum derived C5a based on enzyme assay of myeloperoxidase release.
Biovision | 4995B | C5a human recombinant DataSheet
Biomolecule/Target: N/A
Synonyms: Recombinant human C5a
Alternates names: CD105, ENG, END, ORW, HHT1, ORW1, FLJ41744, Endoglin
Taglines: A potent chemotactic factor for human peripheral blood neutrophils and monocytes
NCBI Gene ID #: Mm.225297
NCBI Gene Symbol: ENG
Gene Source: N/A
Accession #: Q63961
Recombinant: Yes
Source: E. coli
Purity by SDS-PAGEs: 95%
Assay: SDS-PAGE
Purity: N/A
Assay #2: HPLC
Endotoxin Level: <0.1 ng/g
Activity (Specifications/test method): N/A
Biological activity: N/A
Results: N/A
Binding Capacity: N/A
Unit Definition: N/A
Molecular Weight: 75-85 kDa
Concentration: N/A
Appearance: Lyophilized protein
Physical form description: Lyophilized with no additives
Reconstitution Instructions: Centrifuge the vial prior to opening. Reconstitute in sterile PBS to a concentration 100 µg/ml. This solution can then be diluted into other aqueous buffers.
Amino acid sequence: MDRGVLPLPITLLFVIYSFVPTTGLAERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKIFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLS
Euro
USD
British Pound
NULL