Product Description
Hepatocyte Growth Factor (HGF) is a multifunctional growth factor which regulates both cell growth and cell motility. It exerts a strong mitogenic effect on hepatocytes and primary epithelial cells. HGF synergizes with Interleukin-3 and GM-CSF to stimulate colony formation of hematopoietic progenitor cells in vitro and may, therefore, also modulate hematopoiesis.
Biovision | 6456 | Human CellExp HGF Human Recombinant DataSheet
Biomolecule/Target: N/A
Synonyms: Human Cellexp Human Recombinant HGF
Alternates names: NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide, Gamma-brain natriuretic peptide
Taglines: A growth factor regulating cell growth, cell motility, and morphogenesis
NCBI Gene ID #: 4879
NCBI Gene Symbol: BNP
Gene Source: Human
Accession #: P16860
Recombinant: Yes
Source: Synthetic
Purity by SDS-PAGEs: 98%
Assay: SDS-PAGE
Purity: N/A
Assay #2: N/A
Endotoxin Level: < 1.0 EU per 1 g of protein
Activity (Specifications/test method): N/A
Biological activity: N/A
Results: N/A
Binding Capacity: N/A
Unit Definition: N/A
Molecular Weight: 3.464 kDa
Concentration: N/A
Appearance: Lyophilized
Physical form description: Lyophilized in solution of 10 mM Tris-HCl, pH 7.4, with 1 M NaCl.
Reconstitution Instructions: Centrifuge the vial prior to opening. Reconstitute in sterile HO to a concentration 100 µg/ml. This solution can then be diluted into other aqueous buffers.
Amino acid sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH-OH
Euro
USD
British Pound
NULL