Euro
USD
British Pound
NULL
Product Description
Herpesvirus entry mediator (HVEM), also known as TNFRSF14, TR2 (TNF receptor like molecule) and ATAR (another TRAF associated receptor), is a type I membrane protein belonging to the TNF/NGF receptor superfamily. HVEM expression has been detected in peripheral blood T cells, B cells, monocytes and in various tissues enriched in lymphoid cells. The extracellular domain of HVEM has been shown to interact directly with the herpes simplex virus envelope glycoprotein D (gD). Two TNF superfamily ligands, including the secreted TNF (lymphotoxin ) and the membrane protein LIGHT (lymphotoxins, exhibits inducible expression, and competes with HSV glycoprotein D for HVEM, a receptor expressed by T lymphocytes), have been shown to be the cellular ligands for HVEM. Besides HVEM, LIGHT can also interact with LTR, the receptor for lymphotoxin heterotrimer. The role of the HVEM LIGHT /LT receptor ligand pair in immune function and herpesvirus pathobiology remains to be elucidated.
Biovision | 7466 | Human CellExp HVEM/TNFRSF14 human recombinant DataSheet
Biomolecule/Target: HVEM/TNFRSF14
Synonyms: TNFRSF14, ATAR, HVEA, HVEM, LIGHTR, TR2, Tumor necrosis factor receptor superfamily member 14, Herpesvirus entry mediator.
Alternates names: Glia maturation factor beta, GMFB, GMF-B, GMF-beta, GMF
Taglines: A type I membrane protein belonging to the TNF/NGF receptor superfamily
NCBI Gene ID #: 2764
NCBI Gene Symbol: GMFB
Gene Source: Human
Accession #: P60983
Recombinant: Yes
Source: E. coli
Purity by SDS-PAGEs: 98%
Assay: SDS-PAGE
Purity: N/A
Assay #2: N/A
Endotoxin Level: <1 EU/g by LAL method
Activity (Specifications/test method): N/A
Biological activity: N/A
Results: N/A
Binding Capacity: N/A
Unit Definition: N/A
Molecular Weight: 17.0 kDa
Concentration: N/A
Appearance: Lyophilized
Physical form description: Lyophilized from 0.22 m filtered solution in 50 mM tris, 100 mM glycine, pH 7.0. Normally Mannitol or Trehalose is added as protectants before lyophilization.
Reconstitution Instructions: Centrifuge the vial prior to opening. Reconstitute in sterile HO to a concentration 100 µg/ml. This solution can then be diluted into other aqueous buffers.
Amino acid sequence: SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH.
