Product Description
Recombinant Human AITRL Protein [E. coli] | 100-122S/100-122 | ReliaTech
Species: Human
Host / biotech: E. coli
Comment: N/A
Label: N/A
Clone / Antibody feature: N/A
Subcategory: Cytokines & Growth Factors
Category: Recombinant Protein
Synonyms: TNFSF18; TL6; AITRL; GITRL; hGITRL
Isotype: N/A
Application: N/A
Detection Range: Determined by its ability to stimulate IL-8 production by human PBMC using a concentration range of 1.0-10.0 ng/ml. Please Note: Results may vary with PBMC donors.
Species Reactivity/Cross reactivity: Human
Antigen: N/A
Description: AITRL, a member of the TNF superfamily, is expressed in endothelial cells, and signals through the AITR receptor. AITRL regulates T-cell proliferation and survival, and effectuates the interaction between T lymphocytes and endothelial cells. The AITRL gene codes for a type II transmembrane protein comprised of 177 amino acids, including a 28 amino acid cytoplasmic region, a 21 amino acid transmembrane domain and a 128 amino acid extracellular domain. Recombinant human soluble AITRL is a 14.3 kDa protein, containing 126 amino acid residues corresponding to the extracellular domain of AITRL.
Purity Confirmation: > 97% by SDS-PAGE & HPLC analyses
Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
Formulation: lyophilized
Storage Handling Stability: N/A
Reconstituation: N/A
Molecular Weight: 14.3 kDa
Lenght (aa): 126
Protein Sequence: ETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFI
NCBI Gene ID: 8995