Euro
USD
British Pound
NULL
![Recombinant Human I-TAC (CXCL11) Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/1280x1280/products/671513/929356/logo__42078.1651665136__48865.1651684299.jpg?c=2 "Recombinant Human I-TAC (CXCL11) Protein [E. coli]"){kind=logo}
![Recombinant Human I-TAC (CXCL11) Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/100x100/products/671513/929356/logo__42078.1651665136__48865.1651684299.jpg?c=2 "Recombinant Human I-TAC (CXCL11) Protein [E. coli]"){kind=logo}
Product Description
Recombinant Human I-TAC (CXCL11) Protein [E. coli] | 100-058S/100-058 | ReliaTech
Species: Human
Host / biotech: E. coli
Comment: N/A
Label: N/A
Clone / Antibody feature: N/A
Subcategory: Cytokines & Growth Factors
Category: Recombinant Protein
Synonyms: CXCL11; IP9; H174; IP-9; b-R1; I-TAC; SCYB11; SCYB9B
Isotype: N/A
Application: N/A
Detection Range: Determined by its ability to chemoattract IL-2 activated T-cells using a concentration range of 0.1-10.0 ng/ml.
Species Reactivity/Cross reactivity: Hamster, Mouse, Rabbit, Human, Monkey
Antigen: N/A
Description: Human I-TAC (Interferon-inducible T cell alpha chemoacttractant) is an 8.3 kDa protein containing 73 amino acid residues. I-TAC is a novel non-ELR CXC chemokine. It is regulated by Interferon and has potent chemoattractant activity for IL-2 activated T cells, but not for freshly isolated unstimulated T cells, neutrophils, or monocytes.
Purity Confirmation: > 98% by SDS-PAGE & HPLC analyses
Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
Formulation: lyophilized
Storage Handling Stability: N/A
Reconstituation: N/A
Molecular Weight: 8.3 kDa
Lenght (aa): 73
Protein Sequence: FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
NCBI Gene ID: 6373
![Recombinant Human I-TAC (CXCL11) Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/671513/929356/logo__42078.1651665136__48865.1651684299.jpg?c=2 "Recombinant Human I-TAC (CXCL11) Protein [E. coli]"){kind=logo}
![Recombinant Rat TPO Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/672173/930016/logo__42078.1651665136__00781.1651684493.jpg?c=2 "Recombinant Rat TPO Protein [E. coli]"){kind=logo}
![Recombinant Mouse TARC (CCL17) Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/672039/929882/logo__42078.1651665136__37656.1651684453.jpg?c=2 "Recombinant Mouse TARC (CCL17) Protein [E. coli]"){kind=logo}
![Recombinant Human ccbe1 (fragment) Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/670581/928424/logo__42078.1651665136__88040.1651684039.jpg?c=2 "Recombinant Human ccbe1 (fragment) Protein [E. coli]"){kind=logo}
![Recombinant Mouse I-TAC (CXCL11) Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/671514/929357/logo__42078.1651665136__37831.1651684299.jpg?c=2 "Recombinant Mouse I-TAC (CXCL11) Protein [E. coli]"){kind=logo}
![Recombinant Human ApoA-I Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/670460/928303/logo__42078.1651665136__82836.1651683806.jpg?c=2 "Recombinant Human ApoA-I Protein [E. coli]"){kind=logo}
