Euro
USD
British Pound
NULL
![Recombinant Human IL-36RA Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/1280x1280/products/671490/929333/logo__42078.1651665136__23055.1651684293.jpg?c=2 "Recombinant Human IL-36RA Protein [E. coli]"){kind=logo}
![Recombinant Human IL-36RA Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/100x100/products/671490/929333/logo__42078.1651665136__23055.1651684293.jpg?c=2 "Recombinant Human IL-36RA Protein [E. coli]"){kind=logo}
Product Description
Recombinant Human IL-36RA Protein [E. coli] | 100-414S/100-414 | ReliaTech
Species: Human
Host / biotech: E. coli
Comment: N/A
Label: N/A
Clone / Antibody feature: N/A
Subcategory: Cytokines & Growth Factors
Category: Recombinant Protein
Synonyms: FIL1 delta, IL-1F5, IL-1HY1, IL-1L1, IL-1RP3, IL-1ra homolog 1, IL-1 delta
Isotype: N/A
Application: N/A
Detection Range: Measured by its ability to inhibit IL-36γ induced IL-6 production by human PBMCs.
Species Reactivity/Cross reactivity: Human
Antigen: N/A
Description: The IL-1 family is comprised of 11 structurally related ligands, including the recently re-named IL-36RA (IL-1F5), IL-36α (IL-1F6), IL-36β (IL-1F8), and IL-36γ (IL-1F9). The interaction of IL-36 ligands with the IL-1Rrp2 receptor (IL-1R6) can induce various activities, including dendritic cell maturation and activation. IL-36RA can antagonize the NF-kappaB signaling induced by either IL-36α, -β or -γ by binding to the IL-1Rrp2 receptor in a manner that prevents the initiation of functional signaling. Recombinant human IL-36RA is an E. coli derived 17 kDa protein containing 154 amino acid residues.
Purity Confirmation: > 98% by SDS-PAGE & HPLC analyses
Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
Formulation: lyophilized
Storage Handling Stability: N/A
Reconstituation: N/A
Molecular Weight: 17 kDa
Lenght (aa): 154
Protein Sequence: VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD
NCBI Gene ID: 26525
![Recombinant Human IL-36RA Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/671490/929333/logo__42078.1651665136__23055.1651684293.jpg?c=2 "Recombinant Human IL-36RA Protein [E. coli]"){kind=logo}
![Recombinant Human IL-10 Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/671366/929209/logo__42078.1651665136__43557.1651684256.jpg?c=2 "Recombinant Human IL-10 Protein [E. coli]"){kind=logo}
![Recombinant Human IL-11 Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/671376/929219/logo__42078.1651665136__30145.1651684259.jpg?c=2 "Recombinant Human IL-11 Protein [E. coli]"){kind=logo}
![Recombinant Human IL-13 Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/671391/929234/logo__42078.1651665136__80425.1651684265.jpg?c=2 "Recombinant Human IL-13 Protein [E. coli]"){kind=logo}
![Recombinant Human IL-19 Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/671449/929292/logo__42078.1651665136__13847.1651684281.jpg?c=2 "Recombinant Human IL-19 Protein [E. coli]"){kind=logo}
![Recombinant Human IL-7 Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/671344/929187/logo__42078.1651665136__86416.1651684250.jpg?c=2 "Recombinant Human IL-7 Protein [E. coli]"){kind=logo}