Euro
USD
British Pound
NULL
![Recombinant Human OTOR (Otoraplin) Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/1280x1280/products/671810/929653/logo__42078.1651665136__21427.1651684384.jpg?c=2 "Recombinant Human OTOR (Otoraplin) Protein [E. coli]"){kind=logo}
![Recombinant Human OTOR (Otoraplin) Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/100x100/products/671810/929653/logo__42078.1651665136__21427.1651684384.jpg?c=2 "Recombinant Human OTOR (Otoraplin) Protein [E. coli]"){kind=logo}
Product Description
Recombinant Human OTOR (Otoraplin) Protein [E. coli] | 100-353S/100-353 | ReliaTech
Species: Human
Host / biotech: E. coli
Comment: N/A
Label: N/A
Clone / Antibody feature: N/A
Subcategory: Cytokines & Growth Factors
Category: Recombinant Protein
Synonyms: OTOR; FDP; MIAL; MIAL1
Isotype: N/A
Application: N/A
Detection Range: Data not available.
Species Reactivity/Cross reactivity: Human
Antigen: N/A
Description: OTOR, also called Otoraplin and MIAL, is a secreted cytokine and a member of the MIA/OTOR family. Members of this family which also includes MIA, MIA2, and TANGO share a Src homology-3 (SH3)-like domain. OTOR is predominantly expressed in the cochlea of the inner-ear and to a lesser extent in fetal brain and in some cartilage tissues. OTOR appears to be involved in early chondrogenesis of the otic capsule, which is required for normal inner ear development and auditory function. Recombinant human OTOR is a 12.7 kDa globular protein containing 112 amino acid residues.
Purity Confirmation: > 98% by SDS-PAGE & HPLC analyses
Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
Formulation: lyophilized
Storage Handling Stability: N/A
Reconstituation: N/A
Molecular Weight: 12.7 kDa
Lenght (aa): 112
Protein Sequence: MVHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE
NCBI Gene ID: 56914
![Recombinant Human OTOR (Otoraplin) Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/671810/929653/logo__42078.1651665136__21427.1651684384.jpg?c=2 "Recombinant Human OTOR (Otoraplin) Protein [E. coli]"){kind=logo}
![Recombinant Human BCMA Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/670499/928342/logo__42078.1651665136__04346.1651684015.jpg?c=2 "Recombinant Human BCMA Protein [E. coli]"){kind=logo}
![Recombinant Human Lymphotactin Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/671598/929441/logo__42078.1651665136__73964.1651684321.jpg?c=2 "Recombinant Human Lymphotactin Protein [E. coli]"){kind=logo}
![Recombinant Human Visfatin Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/672324/930167/logo__42078.1651665136__37215.1651684552.jpg?c=2 "Recombinant Human Visfatin Protein [E. coli]"){kind=logo}
![Recombinant Human PTHrP Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/671902/929745/logo__42078.1651665136__12791.1651684413.jpg?c=2 "Recombinant Human PTHrP Protein [E. coli]"){kind=logo}
![Recombinant Human Vaspin Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/672220/930063/logo__42078.1651665136__03050.1651684504.jpg?c=2 "Recombinant Human Vaspin Protein [E. coli]"){kind=logo}
![Recombinant Human TSG Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/672198/930041/logo__42078.1651665136__59360.1651684499.jpg?c=2 "Recombinant Human TSG Protein [E. coli]"){kind=logo}