Euro
USD
British Pound
NULL
![Recombinant Mouse SCF Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/1280x1280/products/671958/929801/logo__42078.1651665136__82233.1651684432.jpg?c=2 "Recombinant Mouse SCF Protein [E. coli]"){kind=logo}
![Recombinant Mouse SCF Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/100x100/products/671958/929801/logo__42078.1651665136__82233.1651684432.jpg?c=2 "Recombinant Mouse SCF Protein [E. coli]"){kind=logo}
Product Description
Recombinant Mouse SCF Protein [E. coli] | M30-010S/M30-010/M30-011 | ReliaTech
Species: Mouse
Host / biotech: E. coli
Comment: N/A
Label: N/A
Clone / Antibody feature: N/A
Subcategory: Cytokines & Growth Factors
Category: Recombinant Protein
Synonyms: Kitl; Gb; SF; Sl; Clo; Con; Mgf; SCF; SLF; Kitlg; contrasted; mSCF
Isotype: N/A
Application: N/A
Detection Range: The ED50 as determined by the dose-dependent stimulation of the proliferation of the human TF-1 cell line is in the range of 2-10 ng/ml.
Species Reactivity/Cross reactivity: Mouse
Antigen: N/A
Description: Stem cell factor (SCF), also known as ckit ligand (KL), mast cell growth factor (MGF), and steel factor (SLF), is a widely expressed 28-40 kDa type I transmembrane glycoprotein. It promotes the survival, differentiation, and mobilization of multiple cell types including myeloid, erythroid, megakaryocytic, lymphoid, germ cell, and melanocyte progenitors. SCF is a primary growth and activation factor for mast cells and eosinophils. Mature mouse SCF consists of a 189 amino acid (aa) extracellular domain (ECD), a 23 aa transmembrane segment, and a 36 aa cytoplasmic tail. Proteolytic cleavage at two alternate sites in the extracellular juxtamembrane region releases a 25 kDa soluble. An alternately spliced isoform of mouse SCF lacks 28 aa that encompasses the primary proteolytic recognition site. Within the ECD of the short isoform, mouse SCF shares 93% aa sequence identity with rat SCF and 72%-75% with canine, feline, and human SCF. Rat SCF is active on mouse and human cells, but human SCF is only weakly active on mouse cells. Noncovalent dimers of transmembrane or soluble SCF interact with the receptor tyrosine kinase SCF R/ckit to trigger receptor dimerization and signaling.
Purity Confirmation: > 95% by SDS-PAGE
Endotoxin: < 0.1 ng per µg of mSCF
Formulation: lyophilized
Storage Handling Stability: The lyophilized mouse SCF is best stored desiccated below 0°C. Freeze/thaw cycles will result in significant loss of activity. Avoid repeated freeze-thaw cycles.
Reconstituation: Centrifuge vial prior to opening. Mouse SCF should be reconstituted in 50mM acetic acid or water to a concentration of 0.1 mg/ml. This solution can be diluted in water or other buffer solutions or stored at -20°C.
Molecular Weight: 18.42 kDa
Lenght (aa): 165
Protein Sequence: MKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
NCBI Gene ID: 17311
![Recombinant Mouse SCF Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/671958/929801/logo__42078.1651665136__82233.1651684432.jpg?c=2 "Recombinant Mouse SCF Protein [E. coli]"){kind=logo}
![Recombinant Mouse VEGF144 Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/672230/930073/logo__42078.1651665136__57533.1651684509.jpg?c=2 "Recombinant Mouse VEGF144 Protein [E. coli]"){kind=logo}
![Recombinant Mouse VEGF188 Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/672240/930083/logo__42078.1651665136__18484.1651684515.jpg?c=2 "Recombinant Mouse VEGF188 Protein [E. coli]"){kind=logo}
![Recombinant Mouse VEGF120 Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/672226/930069/logo__42078.1651665136__78413.1651684506.jpg?c=2 "Recombinant Mouse VEGF120 Protein [E. coli]"){kind=logo}
![Recombinant Mouse VEGF164 Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/672232/930075/logo__42078.1651665136__44314.1651684510.jpg?c=2 "Recombinant Mouse VEGF164 Protein [E. coli]"){kind=logo}
![Recombinant Mouse LIF Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/671574/929417/logo__42078.1651665136__69282.1651684314.jpg?c=2 "Recombinant Mouse LIF Protein [E. coli]"){kind=logo}