Euro
USD
British Pound
NULL
![Recombinant Mouse Podoplanin, soluble Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/1280x1280/products/671883/929726/logo__42078.1651665136__28887.1651684408.jpg?c=2 "Recombinant Mouse Podoplanin, soluble Protein [E. coli]"){kind=logo}
![Recombinant Mouse Podoplanin, soluble Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/100x100/products/671883/929726/logo__42078.1651665136__28887.1651684408.jpg?c=2 "Recombinant Mouse Podoplanin, soluble Protein [E. coli]"){kind=logo}
Product Description
Recombinant Mouse Podoplanin, soluble Protein [E. coli] | S01-M46 | ReliaTech
Species: Mouse
Host / biotech: E. coli
Comment: N/A
Label: His-Tag
Clone / Antibody feature: N/A
Subcategory: Soluble Receptors
Category: Recombinant Protein
Synonyms: Pdpn; T1a; Gp38; OTS-8; T1alpha; RANDAM-2; T1-alpha
Isotype: N/A
Application: N/A
Detection Range: Testing in progress.
Species Reactivity/Cross reactivity: Mouse
Antigen: N/A
Description: Podoplanin, also known as glycoprotein 38 (gp38), PA2.26 antigen, T1alpha (T1A), and aggrus, is a 38 kDa type I transmembrane sialoglycoprotein and member of the podoplanin family. Podoplanin is synthesized as a 172 amino acid (aa) precursor with a 22 aa signal sequence, a 119 aa extracellular domain (ECD), a 21 aa transmembrane region, and a short, 10 aa cytoplasmic tail. The ECD contains abundant Ser/Thr residues as potential sites for Oglycosylation, and the cytoplasmic region contains putative sites for kinase C and cAMP phosphorylation. Mouse Podoplanin shares 77% and 46% aa sequence identity with rat and human Podoplanin, respectively. Podoplanin is expressed on glomerular epithelial cells (podocytes), type I lung alveolar cells, lymphatic endothelial cells, and on numerous tumors including colorectal tumors, squamous cell carcinomas, testicular seminoma, and brain tumors. One study shows high expression of Podoplanin mRNA in placenta, lung, skeletal muscle, and heart, and weaker levels in brain, kidney, and liver. Podoplanin is the ligand for Ctype lectin like receptor 2 (CLEC2). Their association is dependent on sialic acid on Oglycans of Podoplanin. Through its association with CLEC2, Podoplanin induces platelet aggregation and tumor metastasis. Podoplanin is also necessary for lymphatic vessel formation, normal lung cell proliferation and alveolus formation at birth.
Purity Confirmation: > 95% by SDS-PAGE
Endotoxin: N/A
Formulation: lyophilized
Storage Handling Stability: The lyophilized protein is stable for a few weeks at room temperature, but best stored at -20°C. Reconstituted sPodoplanin should be stored in working aliquots at -20°C.
Reconstituation: We recommend a quick spin followed by reconstitution in water to a concentration of 0.1-1.0mg/ml. This solution can then be diluted into other aqueous buffers and stored at 4°C for 1 week or -20°C for future use.
Molecular Weight: N/A
Lenght (aa): 126
Protein Sequence: GTIGVNEDDIVTPGTGDGMVPPGIEDKITTTGATGGLNESTGKAPLVPTQRERGTKPPLEELSTSATSDHDHREHESTTTVKVVTSHSVDKKTSHPNRDNAGDETQTTDKKDGLPVVTLEHHHHHH
NCBI Gene ID: 14726
![Recombinant Mouse Podoplanin, soluble Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/671883/929726/logo__42078.1651665136__28887.1651684408.jpg?c=2 "Recombinant Mouse Podoplanin, soluble Protein [E. coli]"){kind=logo}
![Recombinant Human Podoplanin, soluble Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/671882/929725/logo__42078.1651665136__72782.1651684408.jpg?c=2 "Recombinant Human Podoplanin, soluble Protein [E. coli]"){kind=logo}
![Recombinant Rat Podoplanin, soluble Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/671884/929727/logo__42078.1651665136__89669.1651684408.jpg?c=2 "Recombinant Rat Podoplanin, soluble Protein [E. coli]"){kind=logo}
![Recombinant Human CD34, soluble Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/670676/928519/logo__42078.1651665136__94851.1651684060.jpg?c=2 "Recombinant Human CD34, soluble Protein [E. coli]"){kind=logo}
![Recombinant Human CD23, soluble Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/670656/928499/logo__42078.1651665136__73378.1651684053.jpg?c=2 "Recombinant Human CD23, soluble Protein [E. coli]"){kind=logo}
![Recombinant Human TWEAK receptor, soluble Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/672207/930050/logo__42078.1651665136__41777.1651684501.jpg?c=2 "Recombinant Human TWEAK receptor, soluble Protein [E. coli]"){kind=logo}
![Recombinant Human Ephrin-B2, soluble Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/670929/928772/logo__42078.1651665136__40831.1651684122.jpg?c=2 "Recombinant Human Ephrin-B2, soluble Protein [E. coli]"){kind=logo}
![Recombinant Human BAFF receptor, soluble Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/670490/928333/logo__42078.1651665136__82922.1651683813.jpg?c=2 "Recombinant Human BAFF receptor, soluble Protein [E. coli]"){kind=logo}
![Recombinant Human FAS receptor, soluble Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/670959/928802/logo__42078.1651665136__12980.1651684131.jpg?c=2 "Recombinant Human FAS receptor, soluble Protein [E. coli]"){kind=logo}
![Recombinant Human 4-1BB receptor, soluble Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/670492/928335/logo__42078.1651665136__47762.1651683814.jpg?c=2 "Recombinant Human 4-1BB receptor, soluble Protein [E. coli]"){kind=logo}