Euro
USD
British Pound
NULL
Product Description
Mouse IgG monoclonal antibody for ALDH2 detection. Tested with WB, FCM in Human;Mouse;Rat.
Product Videos
Custom Field
Size 100 ug/vial
Clonality Monoclonal
Ig type Mouse IgG2a
Specificity No cross reactivity with other proteins.
Reactivity Reacts with: human, mouse, rat
Application WB,FCM
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH2 (18-48aa SAAATQAVPAPNQQPEVFCNQIFINNEWHDA), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid.
Contents Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification Immunogen affinity purified.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500?g/ml.
Storage At -20?C for one year. After reconstitution, at 4?C for one month. It can also be aliquotted and stored frozen at -20?C for a longer time. Avoid repeated freezing and thawing.
Protein Name Aldehyde dehydrogenase, mitochondrial
Gene Name ALDH2
