A synthetic peptide corresponding to a sequence at the N-terminus of human Fascin (42-73aa KKQIWTLEQPPDEAGSAAVCLRSHLGRYLAAD), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage:
At -20?C for one year. After reconstitution, at 4?C for one month. It can also be aliquotted and stored frozen at -20?C for a longer time. Avoid repeated freezing and thawing.
Rabbit IgG polyclonal antibody for Fascin(FSCN1) detection. Tested with WB in Human;Rat.
Product Videos
Custom Field
Size100 ug/vial
ClonalityPolyclonal
Ig typeRabbit IgG
SpecificityNo cross reactivity with other proteins.
ReactivityReacts with: human, rat
ApplicationWB
ImmunogenA synthetic peptide corresponding to a sequence at the N-terminus of human Fascin (42-73aa KKQIWTLEQPPDEAGSAAVCLRSHLGRYLAAD), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.
ReconstitutionAdd 0.2ml of distilled water will yield a concentration of 500ug/ml.
StorageAt -20?C for one year. After reconstitution, at 4?C for one month. It can also be aliquotted and stored frozen at -20?C for a longer time. Avoid repeated freezing and thawing.