Overview Reviews Product Description Rabbit IgG Polyclonal Anti-Human CD5 Antibody DyLight® 488 Conjugated, Flow Validated. Product Videos Custom Field Size 100 ug/vial Clonality Polyclonal Ig type Rabbit IgG Specificity No cross reactivity with other proteins. Reactivity Reacts with: human Application FCM Immunogen A synthetic peptide corresponding to a sequence of human CD5 (KKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSH). Contents Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3. Purification Immunogen affinity purified. Reconstitution N/A Storage At 2-8?C for one year. Protect from light. Do not freeze. Protein Name T-cell surface glycoprotein CD5 Gene Name CD5 Product Reviews Write a Review Write a Review × Anti-Human CD5 DyLight® 488 conjugated Antibody Rating * Select Rating 1 star (worst) 2 stars 3 stars (average) 4 stars 5 stars (best) Name Review Subject * Comments *
Quick view Details Anti-Human CD5 DyLight® 550 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart Quick view Details Anti-Human CD45 DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart Quick view Details Anti-Human SCRIBBLE DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart Quick view Details Anti-Human NFAT4 DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart Quick view Details Anti-Human ACTN3 DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart Quick view Details Anti-Human CD7 DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart Quick view Details Anti-Human TAPA1 DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart Quick view Details Anti-Human ATF1 DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart Quick view Details Anti-Human PRX DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart ×
Quick view Details Anti-Human CD45 DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart Quick view Details Anti-Human SCRIBBLE DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart Quick view Details Anti-Human NFAT4 DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart Quick view Details Anti-Human ACTN3 DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart Quick view Details Anti-Human CD7 DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart Quick view Details Anti-Human TAPA1 DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart Quick view Details Anti-Human ATF1 DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart Quick view Details Anti-Human PRX DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart ×
Quick view Details Anti-Human SCRIBBLE DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart Quick view Details Anti-Human NFAT4 DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart Quick view Details Anti-Human ACTN3 DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart Quick view Details Anti-Human CD7 DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart Quick view Details Anti-Human TAPA1 DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart Quick view Details Anti-Human ATF1 DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart Quick view Details Anti-Human PRX DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart ×
Quick view Details Anti-Human NFAT4 DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart Quick view Details Anti-Human ACTN3 DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart Quick view Details Anti-Human CD7 DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart Quick view Details Anti-Human TAPA1 DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart Quick view Details Anti-Human ATF1 DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart Quick view Details Anti-Human PRX DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart ×
Quick view Details Anti-Human ACTN3 DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart Quick view Details Anti-Human CD7 DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart Quick view Details Anti-Human TAPA1 DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart Quick view Details Anti-Human ATF1 DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart Quick view Details Anti-Human PRX DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart ×
Quick view Details Anti-Human CD7 DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart Quick view Details Anti-Human TAPA1 DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart Quick view Details Anti-Human ATF1 DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart Quick view Details Anti-Human PRX DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart ×
Quick view Details Anti-Human TAPA1 DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart Quick view Details Anti-Human ATF1 DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart Quick view Details Anti-Human PRX DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart ×
Quick view Details Anti-Human ATF1 DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart Quick view Details Anti-Human PRX DyLight® 488 conjugated Antibody MSRP: Now: NULL344.00 Add to Cart ×