Overview Reviews Product Description Rabbit IgG Polyclonal Anti-Human CD5 Antibody DyLight® 488 Conjugated, Flow Validated. Product Videos Custom Field Size 100 ug/vial Clonality Polyclonal Ig type Rabbit IgG Specificity No cross reactivity with other proteins. Reactivity Reacts with: human Application FCM Immunogen A synthetic peptide corresponding to a sequence of human CD5 (KKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSH). Contents Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3. Purification Immunogen affinity purified. Reconstitution N/A Storage At 2-8?C for one year. Protect from light. Do not freeze. Protein Name T-cell surface glycoprotein CD5 Gene Name CD5 Product Reviews Write a Review Write a Review × Anti-Human CD5 DyLight® 488 conjugated Antibody Rating * Select Rating 1 star (worst) 2 stars 3 stars (average) 4 stars 5 stars (best) Name Review Subject * Comments *
Quick view Details iFluor™ 488 Anti-human CD5 Antibody *L17F12* | 10051050/10051051 MSRP: Was: Now: NULL232.00 - NULL555.00 Choose Options
Quick view Details iFluor™ 488 Anti-human CD5 Antibody *HISM2* | 10050050/10050051 MSRP: Was: Now: NULL232.00 - NULL555.00 Choose Options
Quick view Details iFluor™ 488 Anti-human CD5 Antibody *UCHT2* | 10052050/10052051 MSRP: Was: Now: NULL232.00 - NULL555.00 Choose Options
Quick view Details Goat anti-Human IgG Fc, DyLight® 488 conjugated | AS10 789 MSRP: Now: NULL255.00 Add to Cart Quick view Details Rabbit Anti-Human, Mouse Ceramide Kinase Polyclonal Antibody [DyLight 488 Conjugated] | EA-0033Y MSRP: Now: NULL1,592.00 Add to Cart Quick view Details Anti-Human CD5 Monoclonal Antibody (Biotin Conjugated) | DL20605F MSRP: Was: Now: NULL314.00 - NULL562.00 Choose Options ×
Quick view Details Rabbit Anti-Human, Mouse Ceramide Kinase Polyclonal Antibody [DyLight 488 Conjugated] | EA-0033Y MSRP: Now: NULL1,592.00 Add to Cart Quick view Details Anti-Human CD5 Monoclonal Antibody (Biotin Conjugated) | DL20605F MSRP: Was: Now: NULL314.00 - NULL562.00 Choose Options
Quick view Details Anti-Human CD5 Monoclonal Antibody (Biotin Conjugated) | DL20605F MSRP: Was: Now: NULL314.00 - NULL562.00 Choose Options