Overview Reviews Product Description Rabbit IgG Polyclonal Anti-Human CHRNA3 Antibody DyLight® 550 Conjugated, Flow Validated. Product Videos Custom Field Size 100 ug/vial Clonality Polyclonal Ig type Rabbit IgG Specificity No cross reactivity with other proteins. Reactivity Reacts with: human Application FCM Immunogen A synthetic peptide corresponding to a sequence of human CHRNA3 (DAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQD). Contents Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3. Purification Immunogen affinity purified. Reconstitution N/A Storage At 2-8?C for one year. Protect from light. Do not freeze. Protein Name Neuronal acetylcholine receptor subunit alpha-3 Gene Name CHRNA3 Product Reviews Write a Review Write a Review × Anti-Human CHRNA3 DyLight® 550 conjugated Antibody Rating * Select Rating 1 star (worst) 2 stars 3 stars (average) 4 stars 5 stars (best) Name Review Subject * Comments *
Quick view Details Goat anti-Human IgG Fc, DyLight® 550 conjugated | AS12 1909 MSRP: Now: NULL309.00 Add to Cart Quick view Details CHRNA3 Conjugated Antibody | C31245 MSRP: Now: NULL575.00 Add to Cart Quick view Details Anti- CHRNA3 Antibody | FNab01676 MSRP: Now: NULL338.00 Add to Cart Quick view Details Rabbit Anti-Human, Mouse Ceramide Kinase Polyclonal Antibody [DyLight 550 Conjugated] | EA-0034Y MSRP: Now: NULL1,592.00 Add to Cart Quick view Details Rabbit anti-CHRNA3 Antibody | DL90231A MSRP: Was: Now: NULL348.00 - NULL446.00 Choose Options Quick view Details Goat anti-Rabbit IgG Fc, DyLight® 550 conjugated | AS12 1969 MSRP: Now: NULL255.00 Add to Cart ×
Quick view Details CHRNA3 Conjugated Antibody | C31245 MSRP: Now: NULL575.00 Add to Cart Quick view Details Anti- CHRNA3 Antibody | FNab01676 MSRP: Now: NULL338.00 Add to Cart Quick view Details Rabbit Anti-Human, Mouse Ceramide Kinase Polyclonal Antibody [DyLight 550 Conjugated] | EA-0034Y MSRP: Now: NULL1,592.00 Add to Cart Quick view Details Rabbit anti-CHRNA3 Antibody | DL90231A MSRP: Was: Now: NULL348.00 - NULL446.00 Choose Options Quick view Details Goat anti-Rabbit IgG Fc, DyLight® 550 conjugated | AS12 1969 MSRP: Now: NULL255.00 Add to Cart ×
Quick view Details Anti- CHRNA3 Antibody | FNab01676 MSRP: Now: NULL338.00 Add to Cart Quick view Details Rabbit Anti-Human, Mouse Ceramide Kinase Polyclonal Antibody [DyLight 550 Conjugated] | EA-0034Y MSRP: Now: NULL1,592.00 Add to Cart Quick view Details Rabbit anti-CHRNA3 Antibody | DL90231A MSRP: Was: Now: NULL348.00 - NULL446.00 Choose Options Quick view Details Goat anti-Rabbit IgG Fc, DyLight® 550 conjugated | AS12 1969 MSRP: Now: NULL255.00 Add to Cart ×
Quick view Details Rabbit Anti-Human, Mouse Ceramide Kinase Polyclonal Antibody [DyLight 550 Conjugated] | EA-0034Y MSRP: Now: NULL1,592.00 Add to Cart Quick view Details Rabbit anti-CHRNA3 Antibody | DL90231A MSRP: Was: Now: NULL348.00 - NULL446.00 Choose Options Quick view Details Goat anti-Rabbit IgG Fc, DyLight® 550 conjugated | AS12 1969 MSRP: Now: NULL255.00 Add to Cart ×
Quick view Details Rabbit anti-CHRNA3 Antibody | DL90231A MSRP: Was: Now: NULL348.00 - NULL446.00 Choose Options
Quick view Details Goat anti-Rabbit IgG Fc, DyLight® 550 conjugated | AS12 1969 MSRP: Now: NULL255.00 Add to Cart