Euro
USD
British Pound
NULL
Product Description
Rabbit IgG polyclonal antibody for E3 ubiquitin-protein ligase UHRF1(UHRF1) detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human.
Product Videos
Custom Field
Size 100 ug/vial
Clonality Polyclonal
Ig type Rabbit IgG
Specificity No cross reactivity with other proteins.
Reactivity Reacts with: human
Application WB,IHC-P,IHC-F,ICC,FCM
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human UHRF1 (14-51aa HTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQ), different from the related mouse sequence by six amino acids, and from the related rat sequence by five amino acids.
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification Immunogen affinity purified.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage At -20?C for one year. After reconstitution, at 4?C for one month. It can also be aliquotted and stored frozen at -20?C for a longer time. Avoid repeated freezing and thawing.
Protein Name E3 ubiquitin-protein ligase UHRF1
Gene Name UHRF1
