Integrin alpha 3A antibody was raised in Mouse using a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet he
Host:
Mouse
Specificity:
Reacts exclusively with the cytoplasmic domain of non-phosphorylated integrin subunit a3A
Integrin alpha 3A antibody 100 ug | 10R-8071-100UG | Fitzgerald
Product Videos
Custom Field
Size100 ug
Research areaSignal Transduction
ImmunogenIntegrin alpha 3A antibody was raised in Mouse using a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet he
HostMouse
SpecificityReacts exclusively with the cytoplasmic domain of non-phosphorylated integrin subunit a3A