Integrin alpha 3B antibody was raised in Mouse using a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to
Host:
Mouse
Specificity:
Recognizes specifically the cytoplasmic domain of integrin subunit alpha3B which is present in microvascular structures in brain and heart
Integrin alpha 3B antibody 100 ug | 10R-8072-100UG | Fitzgerald
Product Videos
Custom Field
Size100 ug
Research areaSignal Transduction
ImmunogenIntegrin alpha 3B antibody was raised in Mouse using a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to
HostMouse
SpecificityRecognizes specifically the cytoplasmic domain of integrin subunit alpha3B which is present in microvascular structures in brain and heart