Product Description
DAZAP1 antibody | 70R-1355 | Fitzgerald
Activity Code: ACTIVE
Product Type: Primary Antibodies
Product Subtype: Purified Polyclonal Antibodies
Research Area: DNA & RNA
Short Description: Rabbit polyclonal DAZAP1 antibody raised against the C terminal of DAZAP1
Immunogen: DAZAP1 antibody was raised using the C terminal of DAZAP1 corresponding to a region with amino acids LAFPPPPSQAAPDMSKPPTAQPDFPYGQYAGYGQDLSGFGQGFSDPSQQP
Host: Rabbit
Specificity: DAZAP1 antibody was raised against the C terminal of DAZAP1
Cross Reactivity: Human
Isotype: N/A
IClone: N/A
Species: N/A
Residues: N/A
Tag/conjugate: N/A
Protein Type: N/A
Expression System: N/A
Grade & Purity: N/A
Methode of Purification: Total IgG Protein A purified
Source: N/A
Concentration: N/A
Form & Buffer: Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Storage: Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Shipping Information: *Blue Ice*
Applications: WB, IHC
Bioactivity: N/A
Usage Recommendations: WB: 1.25 ug/ml; IHC: 4-8 ug/ml
Assay Information: DAZAP1 Blocking Peptide, catalog no. 33R-4764, is also available for use as a blocking control in assays to test for specificity of this DAZAP1 antibody
Euro
USD
British Pound
NULL