Product Description
KCNMB3 antibody | 70R-5170 | Fitzgerald
Activity Code: ACTIVE
Product Type: Primary Antibodies
Product Subtype: Purified Polyclonal Antibodies
Research Area: Neuroscience
Short Description: Rabbit polyclonal KCNMB3 antibody raised against the middle region of KCNMB3
Immunogen: KCNMB3 antibody was raised using the middle region of KCNMB3 corresponding to a region with amino acids SLTLLGGALIVGMVRLTQHLSLLCEKYSTVVRDEVGGKVPYIEQHQFKLC
Host: Rabbit
Specificity: KCNMB3 antibody was raised against the middle region of KCNMB3
Cross Reactivity: Human
Isotype: N/A
IClone: N/A
Species: N/A
Residues: N/A
Tag/conjugate: N/A
Protein Type: N/A
Expression System: N/A
Grade & Purity: N/A
Methode of Purification: Affinity purified
Source: N/A
Concentration: N/A
Form & Buffer: Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Storage: Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Shipping Information: *Blue Ice*
Applications: WB
Bioactivity: N/A
Usage Recommendations: WB: 1 ug/ml
Assay Information: KCNMB3 Blocking Peptide, catalog no. 33R-8629, is also available for use as a blocking control in assays to test for specificity of this KCNMB3 antibody