Choose your currency $/£/€ from the header !!!
Product Info Tested Species Reactivity Human
Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human C1orf151
Purification Affinity Purified
Predicted Homology Based on
Immunogen Sequence Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-C1orf151 (ARP44801_P050)
Peptide Sequence Synthetic peptide located within the following region: IVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ
Concentration 0.5 mg/ml