Product Description
Glutathione S-transferase is an enzyme in Bombyx mori (Silk moth) encoded by the GSTd2 gene. GSTs are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into nine classes: alpha, delta, kappa, mu, omega, pi, theta, zeta and microsomal. GSTs play a role in susceptibility to cancer, and other diseases.
Biovision | 7840 | GST-/GSTD2 Active Recombinant Bombyx mori Silk moth DataSheet
Biomolecule/Target: GST-/GSTD2
Synonyms: Glutathione S-Transferase Delta, GSTd2
Alternates names: Glutathione S-Transferase Delta, GSTd2
Taglines: 98% Pure Bombyx mori recombinant GST-/GSTD2, that plays an important role in detoxification.
NCBI Gene ID #: 14256
NCBI Gene Symbol: Flt3-L
Gene Source: Bombyx mori
Accession #: P49772
Recombinant: Yes
Source: E. coli
Purity by SDS-PAGEs: 98%
Assay: SDS-PAGE
Purity: N/A
Assay #2: N/A
Endotoxin Level: < 1.0 EU per 1 g of protein (determined by LAL method).
Activity (Specifications/test method): 20 U/mg as determined with BioVisions GST colorimetric activity assay kit, Cat # K263-100.
Biological activity: 20 U/mg as determined with BioVisions GST colorimetric activity assay kit, Cat # K263-100.
Results: 20 U/mg as determined with BioVisions GST colorimetric activity assay kit, Cat # K263-100.
Binding Capacity: N/A
Unit Definition: One unit of the recombinant GST- is defined as the amount of enzyme that conjugates 1.0 µmole of 1-chloro-2, 4-dinitrobenzene (CDNB) with reduced glutathione per minute at pH 6.5 at 25°C.
Molecular Weight: 26.4 kDa (236 aa, 1-216 aa + His Tag)
Concentration: 2.0 mg/ml
Appearance: Liquid
Physical form description: 2.0 mg/ml solution in 30% glycerol without additives.
Reconstitution Instructions: N/A
Amino acid sequence: MGSSHHHHHHSSGLVPRGSH MTIDLYYVPG SAPCRAVLLT AKALNLNLNLKLVDLHHGEQLKPEYLKLNPQHTVPTLVDDG LSIWESRAIITYLVNKYAKGSSLYPEDPKARALVDQRLYFDIGTLYQRFSDYFYPQVFAGAPADKAKNEKVQ EALQLLDKFLEGQKYVAGPNLTVADLSLIASVSSLEASDIDFKKYAN VKRWYETVKSTAPGYQEANEKGLEAFKGLV NSMLKK