Product Description
Chitinase 3-like 3 gene, also known as YM1 and ECF-L, encodes a precursor protein with 398 amino acid residues with a 21 residue signal sequence. Chitinase 3-like 3 protein is a lectin that binds saccharides with a free amino group, such as glucosamine or galactosamine. Binding to oligomeric saccharides is much stronger than binding to mono- or disaccharides. Also binds heparin and G1cN oligomers, and is produced primarily by macrophages during inflammation. It has chemotactic activity for T-lymphocytes, bone marrow cells and eosinophils.
Biovision | P1312 | Human CellExp CHI3L3 Mouse Recombinant DataSheet
Biomolecule/Target: CHI3L3
Synonyms: Chitinase-Like Protein 3, YM1/ECF-L, CHI3L3
Alternates names: Chitinase-Like Protein 3, YM1/ECF-L, CHI3L3
Taglines: Lectin that binds saccharides with a free amino group, such as glucosamine or galactosamine.
NCBI Gene ID #: 15978
NCBI Gene Symbol: IFNG
Gene Source: Mouse
Accession #: P01580
Recombinant: Yes
Source: HEK 293 cells
Purity by SDS-PAGEs: 95%
Assay: SDS-PAGE
Purity: N/A
Assay #2: N/A
Endotoxin Level: N/A
Activity (Specifications/test method): N/A
Biological activity: N/A
Results: N/A
Binding Capacity: N/A
Unit Definition: N/A
Molecular Weight: N/A
Concentration: N/A
Appearance: Lyophilized
Physical form description: Lyophilized from a 0.2 m filtered solution of PBS, pH7.4.
Reconstitution Instructions: Reconstitute in sterile deionized water to a concentration of 100 µg/ml.
Amino acid sequence: YQLMCYYTSWAKDRPIEGSFKPGNIDPCLCTHLIYAFAGMQNNEITYTHEQDLRDYEALNGLKDKNTELKTLLAIGGWKFGPAS FSAMVSTPQNRQIFIQSVIRFLRQYNFDGLNLDWQYPGSRGSPPKDKHLFSVLVKEMRKAFEEESVEKDIPRLLLTSTGAGIIDVI KSGYKIPELSQSLDYIQVMTYDLHDPKDGYTGENSPLYKSPYDIGKSADLNVDSIISYWKDHGAASEKLIVGFPAYGHTFILSDPSK TGIGAPTISTGPPGKYTDESGLLAYYEVCTFLNEGATEVWDAPQEVPYAYQGNEWVGYDNVRSFKLKAQWLKDNNLGGAVVWPLDMDDFSGSFCHQRHFPLTSTLKGDLNIHSASCKGPYVDHHHHHH