Product Description
Inter-Cellular Adhesion Molecule 1 (ICAM-1), also known as Cluster of Differentiation 54 (CD54), is a member of the immunoglobulin superfamily, and is a cell surface glycoprotein which is typically expressed in low concentrations on endothelial cells and cells of the immune system. The protein encoded by this gene is a type of intercellular adhesion molecule continuously present in low concentrations in the membranes of leukocytes and endothelial cells. Upon cytokine stimulation, the concentrations greatly increase. ICAM-1 can be induced by interleukin-1 (IL-1) and tumor necrosis factor alpha (TNF) and is expressed by the vascular endothelium, macrophages, and lymphocytes. ICAM-1 is a ligand for LFA-1 (integrin), a receptor found on leukocytes. When activated, leukocytes bind to endothelial cells via ICAM-1/LFA-1 and then transmigrate into tissues. ICAM-1 has been implicated in subarachnoid hemorrhage (SAH). Levels of ICAM-1 are shown to be significantly elevated in patients with SAH over control subjects in many studies. ICAM-1 expressed by respiratory epithelial cells is also the binding site for rhinovirus, the causative agent of most common colds.
Biovision | 7486 | Human CellExp ICAM1 /CD54 human recombinant DataSheet
Biomolecule/Target: ICAM1 /CD54
Synonyms: ICAM1, ICAM-1, BB2, BB-2, CD54, CD-54, P3.58
Alternates names: Glia maturation factor beta, GMFB, GMF-B, GMF-beta, GMF
Taglines: A ligand for lymphocyte function-associated (LFA) and Mac-1 integrins
NCBI Gene ID #: 2764
NCBI Gene Symbol: GMFB
Gene Source: Human
Accession #: P60983
Recombinant: Yes
Source: E. coli
Purity by SDS-PAGEs: 98%
Assay: SDS-PAGE
Purity: N/A
Assay #2: N/A
Endotoxin Level: <1 EU/g by LAL method
Activity (Specifications/test method): N/A
Biological activity:
Results: N/A
Binding Capacity: N/A
Unit Definition: N/A
Molecular Weight: 17.0 kDa
Concentration: N/A
Appearance: Lyophilized
Physical form description: Lyophilized from 0.22 m filtered solution in 50 mM Tris, 100 mM glycine, pH 7.0. Normally Mannitol or Trehalose is added as protectants before lyophilization.
Reconstitution Instructions: Centrifuge the vial prior to opening. Reconstitute in sterile HO to a concentration 100 µg/ml. This solution can then be diluted into other aqueous buffers.
Amino acid sequence: SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH.