Euro
USD
British Pound
NULL
Product Description
Programmed cell death 1 (PD1) is a cell surface membrane protein of the immunoglobulin superfamily. It is expressed on the surface of activated T cells, B cells, macrophages, myeloid cells and a subset of thymocytes. PD1 functions as an inhibitory cell su
Biovision | 7498 | Human CellExp PD-1 /PDCD1 human recombinant DataSheet
Biomolecule/Target: PD-1/PDCD1
Synonyms: PD, PD 1, PD 1 protein, PD 1 recombinant protein, human PD 1 protein, human recombinant PD 1 protein, human recombinant PD 1, human PD 1, recombinant PD 1, Human cell expressed PD 1, Human cell expressed PD 1 protein, Human cell expressed recombinant PD 1
Alternates names: Vascular endothelial growth factor A, VEGF-A, Vascular permeability factor, VPF, VEGF, MGC70609.
Taglines: Inhibits the T-cell proliferation and production of IL-1, IL-4, IL-10 and IFN- by suppressing the activation and transduction of PI3K/AKT pathway.
NCBI Gene ID #: 22339
NCBI Gene Symbol: VEGFA
Gene Source: Mouse
Accession #: Q00731
Recombinant: Yes
Source: E. coli
Purity by SDS-PAGEs: 97%
Assay: SDS-PAGE
Purity: N/A
Assay #2: N/A
Endotoxin Level: N/A
Activity (Specifications/test method): N/A
Biological activity: The activity as determined by dose-dependent proliferation of human umbilical vein endothelial cells (HUVEC) was typically found to be 1-5 ng/ml.
Results: 1-5 ng/ml
Binding Capacity: Immobilized Human PD-1, His Tag at 5g/mL (100 L/well) can bind Human PD-L1, His Tag with a linear range of 0.15-1.25 g/mL
Unit Definition: N/A
Molecular Weight: 28.2 kDa
Concentration: N/A
Appearance: Lyophilized
Physical form description: Lyophilized from 0.22 m filtered solution in PBS pH 7.5
Reconstitution Instructions: Reconstitute the lyophilized product with sterile HO at a concentration of 0.1 0.5 mg/ml, which can be further diluted into other aqueous solutions
Amino acid sequence: MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR
