Product Description
Glutathione S-transferase P is an enzyme that in humans is encoded by the GSTP1 gene. Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. The glutathione S-transferase pi gene (GSTP1) is a polymorphic gene encoding active, functionally different GSTP1 variant proteins that are thought to function in xenobiotic metabolism and play a role in susceptibility to cancer, and other diseases.
Biovision | 6347 | Human Recombinant GSTP1 DataSheet
Biomolecule/Target: N/A
Synonyms: Human Recombinant GSTP1
Alternates names: Glutathione S-transferase P, DFN7, FAEES3, GST3, PI
Taglines: Plays a role in detoxification of electrophilic compounds
NCBI Gene ID #: 3603
NCBI Gene Symbol: IL16
Gene Source: Human
Accession #: Q14005
Recombinant: Yes
Source: E. Coli
Purity by SDS-PAGEs: 98%
Assay: SDS-PAGE
Purity: N/A
Assay #2: N/A
Endotoxin Level: < 1.0 EU per 1 g of protein (determined by LAL method).
Activity (Specifications/test method): N/A
Biological activity: Specific activity is 20 U/mg
Results: N/A
Binding Capacity: N/A
Unit Definition: One unit of the human recombinant GSTP1 is defined as the amount of enzyme that conjugates 1.0 µmole of 1-chloro-2, 4-dinitrobenzene (CDNB) with reduced glutathione per minute at pH 6.5 at 25°C.
Molecular Weight: 27.6 kDa
Concentration: 2 mg/ml
Appearance: Liquid
Physical form description: 2.0 mg/ml solution in 30% glycerol without additives.
Reconstitution Instructions: N/A
Amino acid sequence: MGSSHHHHHHSSGLVPRGSHMPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Euro
USD
British Pound
NULL