Product Description
Transferrin is a monomeric glycoprotein found in plasma at an average concentration of 250 mg/100ml. The specific iron-binding protein in plasma, it has a role in the transportation and distribution of iron among the body organs, in iron metabolism and in prevention of iron loss via the kidney. Stored in bone marrow as TF-bound iron, it also possesses bacteriostatic and fungistatic activity. Clinically, decreases in transferrin are observed in congenital disorders, newborns, inflammatory diseases, hypo-proteinemias and nephritic syndrome; increases are found in pregnancy, iron-deficiency anemias and inoculation hepatitis. Transferrin is required by all types of cells in cultures for maximal growth. It is, therefore, an important factor used in defined culture media.
Biovision | 7543 | Transferrin Rat Plasma DataSheet
Biomolecule/Target: Transferrin
Synonyms: Transferrin, Siderophilin, TF, DKFZp781D0156, PRO1557, PRO2086
Alternates names: Transferrin, Siderophilin, TF, DKFZp781D0156, PRO1557, PRO2086
Taglines: The specific iron-binding protein in plasma.
NCBI Gene ID #: 6360
NCBI Gene Symbol: CCL16
Gene Source: Rat
Accession #: O15467
Recombinant: No
Source: Rat Plasma
Purity by SDS-PAGEs: 97%
Assay: SDS-PAGE
Purity: N/A
Assay #2: N/A
Endotoxin Level: N/A
Activity (Specifications/test method): N/A
Biological activity: N/A
Results: N/A
Binding Capacity: N/A
Unit Definition: N/A
Molecular Weight: 80.0 kDa
Concentration: N/A
Appearance: Lyophilized
Physical form description: Lyophilized from 20 mM Na phosphate, pH 7.4 and 150 mM NaCI.
Reconstitution Instructions: Reconstitute in sterile ddHO to a concentration 100 µg/ml. This solution can then be diluted into other aqueous buffers.
Amino acid sequence: QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNP NDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ